General Information

  • ID:  hor004055
  • Uniprot ID:  P09971
  • Protein name:  Diapause hormone
  • Gene name:  NA
  • Organism:  Bombyx mori (Silk moth)
  • Family:  Pyrokinin family
  • Source:  animal
  • Expression:  Expression is restricted to the subesophageal ganglion.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Bombyx (genus), Bombycinae (subfamily), Bombycidae (family), Bombycoidea (superfamily), Obtectomera, Ditrysia, Heteroneura (parvorder), Neolepidoptera (infraorder), Glossata (suborder), Lepidoptera (order), Amphiesmenoptera (superorder), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity; GO:0016084 myostimulatory hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0042811 pheromone biosynthetic process
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  TDMKDESDRGAHSERGALWFGPRL
  • Length:  24
  • Propeptide:  MYKTNIVFNVLALALFSIFFASCTDMKDESDRGAHSERGALWFGPRLGKRSMKPSTEDNRQTFLRLLEAADALKFYYDQLPYERQADEPETKVTKKIIFTPKLGRSVAKPQTHESLEFIPRLGRRLSEDMPATPADQEMYQPDPEEMESRTRYFSPRLGRTMSFSPRLGRELSYDYPTKYRVARSVNKTMDN
  • Signal peptide:  MYKTNIVFNVLALALFSIFFASC
  • Modification:  T24 Leucine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Responsible for induction of embryonic diapause
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P09971-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor004055_AF2.pdbhor004055_ESM.pdb

Physical Information

Mass: 314241 Formula: C116H179N37O38S
Absent amino acids: CINQVY Common amino acids: DGR
pI: 5.63 Basic residues: 5
Polar residues: 6 Hydrophobic residues: 6
Hydrophobicity: -117.5 Boman Index: -8018
Half-Life: 7.2 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 40.83
Instability Index: 1152.92 Extinction Coefficient cystines: 5500
Absorbance 280nm: 239.13

Literature

  • PubMed ID:  NA
  • Title:  NA